PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D01G2094
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family S1Fa-like
Protein Properties Length: 82aa    MW: 9218.9 Da    PI: 10.3066
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D01G2094genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA139.19.4e-441782570
         S1FA  5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                 ++eakG+nPGlivllv+ggll++flvgnyily yaqk+lPPrkkkPvskkk+kre+lkqGv++PGe
  Gh_D01G2094 17 ETEAKGFNPGLIVLLVIGGLLITFLVGNYILYSYAQKTLPPRKKKPVSKKKMKRERLKQGVSAPGE 82
                 689**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046894.7E-411882IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
MSNEYEFADK GDKIIYETEA KGFNPGLIVL LVIGGLLITF LVGNYILYSY AQKTLPPRKK  60
KPVSKKKMKR ERLKQGVSAP GE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.120871e-140boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468304.14e-53PREDICTED: DNA-binding protein S1FA-like
SwissprotQ7XLX68e-19S1FA2_ORYSJ; DNA-binding protein S1FA2
TrEMBLA0A0D2QIR05e-53A0A0D2QIR0_G
STRINGPOPTR_0016s08890.11e-21(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769